DPCstruct | MC1570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 154 ± 20 aa |
| Standard deviation of domain lengths | 20.18 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q5QVW2 | 8-162 | EQSEADIRKQRIHDQLTRDLRRFAANFLRLTSGSGKALELLPQLEKLSASIKAYADAHDGALPPQKTVHQILDSRAALIEYRPWIKD… |
| U7GKR9 | 1-151 | MLDHLERELRVLFANLLRVSRGAGKAYEVGANCAAVVSAYQQYREVEGCYPASHEVSGALDFRKDMDQPFDEMRFGIERIVAGSFQL… |
| A0A2L0WCT1 | 10-161 | None |
| A4YKK1 | 3-201 | None |
| A0A840GC01 | 16-158 | None |
| A0A7Y6W2M3 | 2-184 | None |
| A0A2W5Q4Z7 | 2-144 | None |
| G9ZYB1 | 1-152 | None |
| A0A2Z5UNG0 | 11-139 | None |
| A0A1N6IYN8 | 8-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.