DPCstruct | MC15697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 104 ± 15 aa |
| Standard deviation of domain lengths | 15.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3GX80 | 8-112 | VSKPKPYSKNRPSYRKGQVDEVWENAKDTLTGKVYDPTGKEITWDKTKPRNGQWDMGHIPGEKYSEIHELYMDGTITKKEFLEWYKN… |
| J2ZCX5 | 132-250 | VDENGVPHIDPSDPRPYLNPKNRPSLKEQTILDVWNEEVRPDGTVVDPAGRVIEWTPGTSRRGVWDMGHIPGEKYHDRWLEYVNGEM… |
| A0A4S8QEC2 | 73-179 | None |
| A0A378N7H5 | 882-974 | None |
| A0A7X5BIN1 | 415-513 | None |
| A0A2N6VLN6 | 142-327 | None |
| A0A6L5TD63 | 106-209 | None |
| A0A5C4PP06 | 4-91 | None |
| R7FFL2 | 159-279 | None |
| A0A1G7WT08 | 202-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.