DPCstruct | MC15694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 7.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E4WGN4 | 1-78 | MFNFKIYNKISSIDANQWNKCAGNSNPFLSYIFFKNLEDSNSIGENTSWVPNYISIILKNDIVAFVPLFIKLDSQGEY |
| A0A6G8NM17 | 4-83 | KVEIHVVDSLDSVTPDEWNRLAGDNPFVRHEFLTALQDTGCAVARTGWRPHFLLLKRDDKLTGAMPLYLKKHSRGEYVLL |
| A0A017HW20 | 2-88 | None |
| A0A835XF97 | 150-229 | None |
| A0A7Y8GM86 | 1-79 | None |
| A0A5J4YHQ7 | 136-228 | None |
| A0A1P8AY18 | 80-167 | None |
| A0A3N7FGT1 | 112-195 | None |
| A0A2S6VSE6 | 108-174 | None |
| A0A7X0JL32 | 4-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.