DPCstruct | MC15691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 121 ± 6 aa |
| Standard deviation of domain lengths | 6.21 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0WKS6 | 2-125 | ILREDLGVTISAQALVMPILAYNFGQISLTAIVVNSLILWTVPFTMISGFLTVFVGFVNNISGQIMGVVPTVLLTYFIDIVEFFAKI… |
| A0A4V1S3K8 | 8-120 | LILVPLAAQLATLPLVVLYFNLVSPVSILANVLTVHLVALTMLFGGIGLFAGIINLSLADFINMGTGFLTDLFIWLVKLCASLPGAA… |
| A0A661VA89 | 38-167 | None |
| A0A1F4UX48 | 7-138 | None |
| A0A2N5ZPY6 | 158-277 | None |
| A0A1F5H9C2 | 25-145 | None |
| A0A7C4A6U2 | 110-231 | None |
| A0A2H0WXY3 | 14-136 | None |
| A0A3D0Y5F0 | 60-175 | None |
| K2CP57 | 71-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.