DPCstruct | MC15690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 160 ± 20 aa |
| Standard deviation of domain lengths | 19.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R4UZS3 | 176-329 | SIRTALIGMADYLADTDVPIDYQRRRRSDYSTLLPDTAWRQICRDTATPGPSPARARIARCYLFERLSGQPASTSPWALDHGAFRTK… |
| A0A4R1SVV1 | 1-174 | MIGGPENTDRLVKSITELAVILTLDPSPIDYRRRRELDWFMILTKPDWLDLCDAAGHNPGGDVRLRNAKRYLFQRATLAPLSALPSE… |
| I2AB99 | 1-131 | None |
| J9WC96 | 316-473 | None |
| A0A6C1BUQ8 | 473-602 | None |
| A0A2S6A3U0 | 2-161 | None |
| A0A0D8HN16 | 426-609 | None |
| A0A5P8K7X2 | 137-295 | None |
| A0A6N7CSU2 | 159-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.