DPCstruct | MC1569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 158 ± 13 aa |
| Standard deviation of domain lengths | 13.32 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402SX46 | 1-139 | MITPEAYGTASWRRAINSLDDYEKAWILYCYGEQHTYMNHMLICEYLWLQMHDRLRASRKRITDDMTGNLITLAGIMTWNAAQLMSG… |
| A0A1B7HG83 | 1-173 | MITLPGDPVPGQQSRAKGSSIALVQPVEFRTASWRRALATLDKQEHAWLSWCYAGDLSFAHQVAITEWAWAEFKAALGSKKIAGKTV… |
| A0A423HS42 | 129-275 | None |
| A0A5U6SG42 | 92-248 | None |
| W1I4D0 | 8-147 | None |
| W1HW35 | 1-161 | None |
| A0A5A9CQN5 | 68-246 | None |
| A0A6M1CPM7 | 19-167 | None |
| A0A3F3I830 | 48-209 | None |
| A0A5W0X7J9 | 58-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.