DPCstruct | MC15688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 159 ± 13 aa |
| Standard deviation of domain lengths | 13.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5HYS6 | 66-202 | ESNEEFPFSVKESDLPKTWSFKPLVKQRINYPTWVITQESDVLDEPPYANLFIDGSSAEYYFTVNQVETKEIMVQDENRELQTAFVN… |
| R2NW26 | 129-297 | AEQPALPEVKEQPAAPETEDLSAYPYAVRVNTLSNPLTFTFTGANVPVSARVNFNEGTVTFVDQSSGGKTIIESEDDYFLVETVYSM… |
| H3NJR2 | 139-280 | None |
| A0A5R9EKJ8 | 17-193 | None |
| A0A2G9VLN0 | 55-221 | None |
| A0A806EW25 | 1-152 | None |
| A0A4P5P979 | 32-189 | None |
| A0A1E8YG51 | 567-725 | None |
| A0A0R1R973 | 81-231 | None |
| A0A1S6IPV1 | 60-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.