DPCstruct | MC15687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 7.84 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5KE36 | 3-88 | LATLRSVDSYFHRFRSNVRFASRPQVSTNSHGRTWGRHHLYDPVILSKLVEIYRFYHNWMEPGVDRKTPAMRIGLAKGRIYERDLL |
| A0A411YY67 | 2-80 | DAWFNLARRRVTGFERGLPTASNQQRIWHAYGFYDPDMVPKIVTILRFYHNWLLRGQDAATPAMRIGLAKGLIYPRDLF |
| A0A1L8MIU9 | 21-117 | None |
| A0A0F9EIC7 | 223-309 | None |
| A0A7Y5EPJ4 | 61-149 | None |
| A0A2G2LC81 | 24-119 | None |
| A0A1J4QGN3 | 320-403 | None |
| A0A6L7RT78 | 1-74 | None |
| A0A259RR16 | 3-77 | None |
| A0A081NJ17 | 100-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.