DPCstruct | MC15684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 109 ± 9 aa |
| Standard deviation of domain lengths | 8.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D8XKY2 | 1-96 | MTKHEQRKQMPVYTGVLKYFPTAIFEISKVSQLGNKQHHPDKELHWDKSKSKDHLDAGVRHIIDHSNNPIDEDGMLHLAKAAWRILA… |
| A0A5E8KTC0 | 4-114 | MHLPTDSAARKGIPLAEGMLFYFPAALAEVAKLSKAGNDKHSPGQPLHHARGKSADHADCIIRHLIDSGTIDPEDGIRHSAKVAWRA… |
| A5EQN2 | 39-151 | None |
| A0A0F8YDT8 | 1-114 | None |
| A0A1G0I5H8 | 46-168 | None |
| A0A2E9RV32 | 210-317 | None |
| A0A5C7PWN6 | 4-129 | None |
| A0A0F9ER95 | 11-105 | None |
| A0A7V9IQ52 | 79-181 | None |
| A0A1L3ZSE4 | 86-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.