DPCstruct | MC15681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 177 ± 17 aa |
| Standard deviation of domain lengths | 16.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2Y7X5 | 59-238 | REQYLSDPAMKRVIDLWFKEEREHSRLLGDMLKRLGGEEIRSHWSFSLFCAVRKFLGVRFELQALLGTEIVSNVYYKMLRKHGKDVA… |
| A0A4Q2JR70 | 1-193 | MHLLARAERAGDPAYTRALALLVEEEQKHSRLFARGLDHLNGSTLSSHWSDAVFTWFRRMLGLRTEIALFLIAEATAMEYFRALATS… |
| A0A1I6QWI5 | 5-142 | None |
| A0A3G5T4E5 | 1-173 | None |
| A0A2E8Q0P3 | 77-277 | None |
| A0A2D5ZAE8 | 19-200 | None |
| A0A3C1AZE9 | 4-165 | None |
| A0A177QF89 | 155-326 | None |
| A0A5S5BR88 | 56-237 | None |
| F3ZLA2 | 64-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.