DPCstruct | MC1568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 141 ± 13 aa |
| Standard deviation of domain lengths | 13.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523DI27 | 1-141 | MKWWEQWAFNLLHGVVAVTGVAYLYMKQVMVATDPFAVINHPWQSPMLSLHIVAAPVFIAFFGMLFRSHTLAKLVSPNAANRRTGWT… |
| A0A1A9NLA7 | 1-147 | MRGYPGWFYPALLLTVFGLVLTGGLLTPTLLDLRLEWDMPWRLEGNGQIAVAALHAAVSFWMLTMLGSLWNIHMRAGWRHRKHWRSG… |
| A0A0E3ZK80 | 1-123 | None |
| A0A0K8QL18 | 11-149 | None |
| A0A2E9VFK9 | 80-207 | None |
| A0A519G6L0 | 1-174 | None |
| A0A2N2TYY2 | 4-152 | None |
| A0A3S0BRX8 | 28-175 | None |
| A0A2E4A164 | 16-147 | None |
| A0A2A4PEF3 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.