DPCstruct | MC15677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 122 ± 23 aa |
| Standard deviation of domain lengths | 23.00 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2ID23 | 27-133 | DRQGDGPIRAKLEEGSGKLALDLRLSSSNASSMPELLEQLWKARAEKKKMRKTIREFEEDFYQHNGRNVQKEDRVPMLEEYREYKRI… |
| A0A151MPL7 | 1-97 | MLIGLGPNNANGFTLLTSENNTRFKVLLLEHLRETKADKRRLHKGLREFEEQFFKQTGRSPKKEDCILMAEEYSEYKHTKFKILEVL… |
| A0A401PBB9 | 678-821 | None |
| A0A7N6A9B4 | 64-161 | None |
| A0A1L8HMC9 | 446-602 | None |
| R7VDZ2 | 1-108 | None |
| A0A1A8RDI7 | 191-351 | None |
| A0A1A8P8E3 | 552-692 | None |
| A0A060XZH9 | 261-368 | None |
| A0A1A8EZZ7 | 866-999 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.