DPCstruct | MC15674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 6.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2KHM9 | 87-162 | VTDMCEKNIGKIKFGVLVESYLNNIEVSKWADIVLATGSSIVNNTLHELLPFKKKLILYGVTCAGAAKVMGLKRWC |
| A0A373NMW3 | 50-126 | IINGSLKFGIRVEDGTAMKEEIRDSYAELILCTGSTLCNGLIIDYLDLDKEVLFFGTTASGAAPLLGLKRICFADKY |
| A0A1V4V8K5 | 64-142 | None |
| R6JMX2 | 6-86 | None |
| A0A7C4DDB9 | 73-146 | None |
| A0A847BQE7 | 50-128 | None |
| A0A7Y8LPZ7 | 128-209 | None |
| A0A3G9D1W6 | 9-84 | None |
| A0A373HNA3 | 1-61 | None |
| A0A1V4WSP9 | 116-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.