DPCstruct | MC15671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 6.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A0CSE4 | 1-73 | MLLDKINDIGNNADKTIPGVFAGQGPNGTRGDVFFKIKGNDVVVTKPDGTFVTILKGGVNNTSVKNALKGEPR |
| A0A6L6B9Z7 | 529-600 | SDPQVRQKFKSRIERIFLNVEEKRVNFYRGQGKNGLEGVVLLYRRGHDVLVLSLEGNFITLLVGGINSQRWI |
| A0A661NHL6 | 203-274 | None |
| E4ZCK9 | 297-379 | None |
| A0A836W8K4 | 201-276 | None |
| A0A156QTJ8 | 124-211 | None |
| A0A542CXH0 | 579-666 | None |
| A0A066UJN8 | 129-209 | None |
| A0A2K9P189 | 140-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.