DPCstruct | MC15670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 283 ± 32 aa |
| Standard deviation of domain lengths | 31.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139HBX9 | 1-260 | MHYVRFLKTPKVRVDRGTVTLQAVLTLTTDLGETFYPNALELIACLRDTADDGDIYLRKKLQWEAGARAVNVSIDLSRQDIEWPACM… |
| A0A316UY76 | 1-368 | MPFQYIGFQRLPPSSLSPSQSLQVAPLIANDLRDEVFLPEDGEDGVELKLAWVMEKHDAAQGREGFVVVKTEQSVQWIGPDSAYRKV… |
| A0A0C9M6U1 | 172-481 | None |
| A0A066WYK1 | 2-294 | None |
| A0A0E9NIY0 | 41-321 | None |
| Q2GT47 | 1-282 | None |
| A0A2G4T9Y3 | 32-302 | None |
| A0A3M7MIC2 | 251-503 | None |
| A0A4S4LUW7 | 1-273 | None |
| A0A2W1GB69 | 1-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.