DPCstruct | MC1567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6QSZ6 | 2-81 | LFIVSRERMDLYEALRGALWNELDCEIILDRRERERRQGERRAVARGGHDRRRAQRRERMLVDREVRECGWAVVDITTWP |
| A0A2V6V156 | 8-78 | SGGSEPRILIVVARERRDLYEYFEHHLADIDDIKIVLDRRSARRDPPAGGDRRGREDMTDELQQRGFIIIH |
| A0A1F7M487 | 4-80 | None |
| A0A2V7DDD2 | 1-72 | None |
| A0A2V6TD67 | 32-109 | None |
| A0A353VAR2 | 6-83 | None |
| A0A2V7CX14 | 25-102 | None |
| A0A1Q7G0V5 | 2-76 | None |
| A0A2V7BCS2 | 8-95 | None |
| A0A2V6QUY3 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.