DPCstruct | MC15666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 589 ± 93 aa |
| Standard deviation of domain lengths | 92.90 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.73 |
| Pfam Score | 84.63 |
| Assigned Pfam label(s) | PF01267- PF06732- CL0459 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A044V441 | 3-522 | IKKKYESGAATNYITRGRALKKLQLSLKDFRRLCILKGIYPHEPSHKKKVNKGSTENRVYYYAKDINFLASEPIIKKFREYKIFLKK… |
| A0A316UIW8 | 4-599 | LKKRGESGAAKNFVTRNQALKKLQVSLSDFRRLCILKGIHPQQPRHVKRANKGSTAPASFYYAKDIQYLAHEPILRSLRDHKTFAKK… |
| A0A6J0MP83 | 5-495 | None |
| S9WDQ8 | 2-498 | None |
| A0A0F8XRX5 | 168-871 | None |
| A0A7R8ZZI0 | 17-622 | None |
| A0A2G8LJC3 | 1-593 | None |
| A0A2J8AGT9 | 9-478 | None |
| A0A5Q3CYN9 | 1-711 | None |
| A9BK35 | 1-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.