DPCstruct | MC15662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 116 ± 5 aa |
| Standard deviation of domain lengths | 4.68 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0490 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q9BGB9 | 80-191 | IKGQLNDFRIDEEEISISFQGPGYTADFFVNRADGKYELTETKMGIIAVINDLHKGRDTGKSWSWVIDFSAIFMIVISVTGLILLLF… |
| A0A510HYK3 | 1-117 | MGLRGRVADHGEAGEEVWVSFRAPGYAADAQVDPRTGAYRMVVTDYGLVAVLNDLHKGRDAPGGWKLFLDLSALFLALVSLTGLLLG… |
| A0A3C1QWN1 | 289-402 | None |
| A0A6L3ZYD9 | 62-169 | None |
| A0A518IY14 | 251-371 | None |
| A0A359FGT3 | 156-269 | None |
| A0A2I6SB58 | 100-220 | None |
| A0A258BB11 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.