DPCstruct | MC15661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Standard deviation of domain lengths | 15.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P4ATW8 | 1-90 | MGEHWAQPQNLPFGPIYGVIKEKLVFVEIMVSQADFAAGKSWTEALKPLTGHAVDHVDLEFLPKGHEGYEVPHYDIHAYFVSHQEHL… |
| A0A2U0SP76 | 28-135 | LPDQSVLPSDVVKISDVVPMMGEHWANPANLPLGPIYCVHEGKVVCIEYMMSQEDFMNGTSWTELSGLTDLPSINHVDLTFEAEGHE… |
| A0A7V3F9T4 | 11-122 | None |
| A0A292YRR6 | 131-230 | None |
| A0A7Y4GXS9 | 100-202 | None |
| A0A7C2XNH9 | 36-150 | None |
| A0A523DFS7 | 135-267 | None |
| A0A7X3QC99 | 192-318 | None |
| Q53VW9 | 11-112 | None |
| A0A1G2EBZ5 | 33-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.