DPCstruct | MC1566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 223 |
|---|---|
| Mean domain length (aa) | 155 ± 30 aa |
| Standard deviation of domain lengths | 29.88 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 25.93 |
| Pfam Score | 95.08 |
| Assigned Pfam label(s) | CL0270- PF00330- CL0063- CL0364- CL0381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6UUY5 | 32-187 | ISPAGAAVLVFRSNVPAIAEHCFKYVDAEFVARAKAAGRGIIVGGEIYGQGSSREAAAVGPMHLGIRAVIVKSFARIHRANLINWGI… |
| A0A821Z689 | 79-228 | QDLTDMPILMKIKGKCTTDHISPAGVWLKYRGHLDNISNNMLIGAINEENGEANNIQNTMTNQQGKVPDTARYYQSKNIPWVVIGDQ… |
| A0A158IL83 | 30-179 | None |
| A0A7J0G2B0 | 166-316 | None |
| A0A835CTA6 | 234-368 | None |
| A0A484YK36 | 30-180 | None |
| A0A1Y1U7A2 | 456-584 | None |
| A0A7C7IUC1 | 11-157 | None |
| A0A2P2H6V5 | 662-810 | None |
| A0A4Q4W4Z4 | 26-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.