DPCstruct | MC15659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 5.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 33.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J1EU15 | 1-76 | MALLVMVVVNQLEAHVLGPLIVGRATRLHPVTAIAAILTGGTLFGLWGALLAVPAAAFLKVVLEDYYKGSRFYREG |
| A0A140K484 | 2-62 | LQQIQDNLISPRIMENTVHISPVIVFLSLLIGARVAGLLGIFLAVPIAGVIVSWLEIDEIK |
| A0A412IAM5 | 2-71 | None |
| A0A1G8ZBQ6 | 1-78 | None |
| A0A7C1URE7 | 14-88 | None |
| A0A847AU40 | 66-134 | None |
| A0A7X6ZUY1 | 4-71 | None |
| A0A2X1YWV5 | 2-62 | None |
| A0A3D4IL26 | 25-95 | None |
| A0A822LJL3 | 57-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.