DPCstruct | MC15655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 8.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3E1S7 | 1-58 | MIGYSQFPRKNILCVDMKSFYASVSAVTLGLNPMTCYLAVVGNTDRQGSVVLAASPAL |
| A0A2B0JY76 | 1-61 | MFDYSKCMNRMIFCIDLCSFFASCACVMRGLDPLKVKLAVVGDVNRKGSIVLAATPELKKM |
| A0A0J7CXV5 | 1-51 | None |
| A0A2B8JCF3 | 1-60 | None |
| A0A7M2QU37 | 1-53 | None |
| T0VIA5 | 9-73 | None |
| A0A1X0V4J8 | 8-71 | None |
| A0A380JVM1 | 3-63 | None |
| A0A7U5HSD7 | 1-65 | None |
| X8H6P6 | 2-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.