DPCstruct | MC15652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 110 ± 16 aa |
| Standard deviation of domain lengths | 16.30 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08895 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9YHH0 | 1-110 | MSVTFYPAGHLGDNDPQVNVNNGNAATLLGLLGHDTDYPGGVEPAPVFLGRVLTALALVDTATDDAHGRPPVHDGRVVYGGRSPGLL… |
| A0A1Q4CBU8 | 1-93 | MLVTFYSKAYEDITYFGEIAKTLIHMMGHSGAIPGAIKAQDLPAALDSLRHELQNSKAADAEDDNAVGLAKRAVPLINLIQAAIKKD… |
| A0A420EBP3 | 20-125 | None |
| A0A3N8CD64 | 1-110 | None |
| A0A5C7K586 | 18-122 | None |
| A0A1E5JVN1 | 1-77 | None |
| A0A1Y2QE07 | 68-177 | None |
| A0A2G6EEQ0 | 1-102 | None |
| A0A5C7KKF7 | 91-210 | None |
| C3X5M3 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.