DPCstruct | MC15650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 94 ± 19 aa |
| Standard deviation of domain lengths | 18.62 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 24.62 |
| Pfam Score | 92.77 |
| Assigned Pfam label(s) | PF01052- CL0355- PF16973 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7PW40 | 2-75 | DIPVKLTVELGRTKLTIKQLLELAQGSVIELDGLAGEPMDILINGYLIAQGEVVVVDDKYGIRITEIITPSERV |
| A0A519BMT5 | 136-228 | KKVEFASFDVNDKTSEPPKNLEFILDIPLSISVELGRTKMVINDMLQLGQGSVIELDKLAGEPLEVYVNNKLMAKGEVVLVNDKFGV… |
| A0A3M0Y1Q0 | 195-292 | None |
| A0A0Q0I5N2 | 23-171 | None |
| A0A833L014 | 234-320 | None |
| T0DZ52 | 84-219 | None |
| A0A074M3R2 | 8-87 | None |
| A0A655Q260 | 52-153 | None |
| A0A1V5FF49 | 2-66 | None |
| A0A7C3PXN1 | 161-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.