DPCstruct | MC1565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 126 ± 19 aa |
| Standard deviation of domain lengths | 18.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.04 |
| Pfam Score | 89.17 |
| Assigned Pfam label(s) | PF07879- PF05233 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534C1G8 | 3-107 | EPRTIKKYPNRRLYDTVESRYITLADIRRLVIERVDFVVIDKKTQGDITRSILLQVIAEQEHVGEPLMSRDFLSQVIRSYGDAMRSM… |
| A0A2V6UK69 | 1-143 | MAYVIKRYSNRKLYDTQESRYVTLEEIEEMIRAGREISVVDAASGEDLTSVTLTQIILENERTHRANLPSAFLHQLIKHGEAWQEFV… |
| A0A845DCT4 | 13-127 | None |
| A0A7X0HP60 | 1-101 | None |
| A0A3A0AS00 | 2-144 | None |
| A0A846PNS0 | 1-79 | None |
| A0A1G3ZUP0 | 1-110 | None |
| A0A6M1ZWH7 | 2-125 | None |
| A0A4U1JBB2 | 35-181 | None |
| A0A350YH68 | 7-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.