DPCstruct | MC15647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 147 |
|---|---|
| Mean domain length (aa) | 169 ± 32 aa |
| Standard deviation of domain lengths | 31.80 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.17 |
| Pfam Score | 98.11 |
| Assigned Pfam label(s) | CL0039- PF10148- PF01871 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843HQE4 | 6-132 | IGYPEPVYPLIDAVIDSASSAAMRDPRFPSVDESELDSLEYEITVLTKPQIIEVEKPIDYLDNIIIGEDGLIVERGFYRGLLLPQVA… |
| J9EK21 | 9-169 | YDQAFDDIGDHPLFVTYNLNDKLRGCIGTFKADKLGKQLQSYSLVAALYDKRFNPLSKKELQQVQCEISLLTEFEKINDVHEWEVGK… |
| U6LYG9 | 184-379 | None |
| A0A7C2XTQ6 | 25-196 | None |
| A0A7C5LK60 | 351-529 | None |
| A0A7J3ZAU0 | 5-155 | None |
| A0A3C0PH34 | 335-519 | None |
| A0A482WX94 | 24-251 | None |
| A0A6P8S8F4 | 72-252 | None |
| A0A7R8GZ51 | 3-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.