DPCstruct | MC15639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 93 ± 3 aa |
| Standard deviation of domain lengths | 3.14 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4DZ64 | 11-98 | LSGYPSQLYDEVLTGWRSMEFQAMTRGGVRTEKIWMNYPEGRAYSHAFAGKDYNDRSRIKRKVERWRAKYAALPSAERLAIMVALNEV |
| A0A0Q5BMA3 | 114-202 | SGYASKLYADLLPGWQRIDIPGWSQAGAVIESLWVNYTPSDDLHDYQHIGATFREREQIRRRRSRVLSRIQALPTPERLAMLEELAA… |
| A0A7C4IA10 | 183-280 | None |
| A0A1G6W4V1 | 92-180 | None |
| A0A0H4A0X8 | 32-123 | None |
| A0A0H3ZVX4 | 1-90 | None |
| A0A7W0LVN0 | 152-246 | None |
| A0A7V9SQL2 | 92-185 | None |
| A0A510BP10 | 123-217 | None |
| A0A1C4G968 | 68-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.