DPCstruct | MC15638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 134 ± 26 aa |
| Standard deviation of domain lengths | 26.02 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1D369 | 145-253 | TGYRYMSKDAPYIDQLSKTKVIPVNSNGTYFSFNKFDSPAPGKLQVPHDASIRGSFDTLQIIDDIRIPNGNWGKANYLEPLTKDFPE… |
| A0A1G3P4T2 | 49-158 | TGYRYMDSNASYLNDLKKNMTIPENNKGTYISFDKLDTPNPGKLQVPHDASYRGTFDTLQVVDDLKIPKGDWGKSSHLEPITETNPK… |
| T0GIL1 | 764-915 | None |
| A0A5E7W7P5 | 146-326 | None |
| A0A3A8ZN65 | 7-169 | None |
| A0A2V4E600 | 28-187 | None |
| A0A2C6CC43 | 126-273 | None |
| A0A318GTB0 | 215-358 | None |
| A0A851GGT0 | 3-116 | None |
| A0A7X0SVH3 | 2-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.