DPCstruct | MC15632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 507 ± 96 aa |
| Standard deviation of domain lengths | 96.29 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 15.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535HSJ6 | 17-480 | AFALGGAMRSPLEPPLVELTNETWSKFVDQGITVPTDPGDAAEIAAERVSDRPWAKEQAKQRGYGGEQMDKLIDAVMNAPGIGELFQ… |
| A0A7Y5WUJ0 | 1-456 | DAAAAARRADVEAARARARLGSEADLERAAIRGLIPLARVEDVYAAHYDAETVGVLVALLEDDRARYVAQQEARDQAAQRGTSRGIN… |
| A0A532UPK9 | 152-688 | None |
| A0A497AZ61 | 526-899 | None |
| A0A497BE70 | 89-598 | None |
| A0A3R9QBU7 | 54-442 | None |
| A0A1Q7RPW7 | 26-529 | None |
| A0A2D6X8M4 | 85-746 | None |
| A0A497BG03 | 99-661 | None |
| A0A0F9SM32 | 12-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.