DPCstruct | MC15631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 108 ± 16 aa |
| Standard deviation of domain lengths | 16.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6JMM8 | 33-146 | KDLATVSNPVTSPSGKYQLVIKEEIVDGTKHNKFDIFKISDGKPGTSAIFSSKVLFRTRDTLYFLWGDNDSVWVYSGDLGTFFWERA… |
| A0A250INC6 | 14-136 | MLIALAAVWVGCPDKGPAPLTSPSGRYQLHSFQEVDGRGARWVRFRITDATTGNEVFTCPERWLHGHRTEFYWDEQDRAWVLSSDVG… |
| A0A355KXC5 | 50-137 | None |
| A0A7X8BN05 | 16-154 | None |
| A0A3E4U2Y3 | 260-361 | None |
| A0A2N2PV43 | 6-108 | None |
| A0A4P8ZM99 | 12-116 | None |
| A0A1G4S860 | 119-204 | None |
| A0A2N3SF27 | 19-137 | None |
| A0A316BFZ5 | 192-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.