DPCstruct | MC15627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 14.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A250I908 | 8-119 | RERGWALAAGLALLLWPRTPEHFNPCGGLGESPSFTDGKELSWGVIAYPMPEKPFKEQRTPPCMPGLEVEIRGGCWVQAAQSAPCPR… |
| S9PJY8 | 24-134 | AGLLLAGKPGHPPSPAPVELSDIRSEVDAPIVTGSAPPAPTSLAYPLPKKPFRNQAITPCKPELWEEEINKGCWMALDQRPPCLDVQ… |
| A0A250IX20 | 120-237 | None |
| Q092C9 | 88-227 | None |
| E3FI67 | 23-159 | None |
| A0A848LZX4 | 165-286 | None |
| A0A250JEX6 | 1-113 | None |
| A0A250J4Q1 | 42-175 | None |
| L7UG44 | 1-157 | None |
| A0A085WI57 | 284-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.