DPCstruct | MC15626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 69 ± 3 aa |
| Standard deviation of domain lengths | 3.37 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G2GWR3 | 130-192 | NGVACTGTIAEQTYVNSTIILEAADSAFSSAIGASSGATYTDMETADGGKTWTIAKIVIPAME |
| A0A4Z1I5Q5 | 1-72 | MTGWGTGTECSDDCTGTVAKQKYLNTTITLASADPNFGATLGVSQGTTYTGLTSEQGSLFWKIAEINVPSMS |
| A0A4V4HUK7 | 91-162 | None |
| A0A093XLX3 | 1-67 | None |
| A0A6A5YGP0 | 20-91 | None |
| A0A094AY25 | 45-116 | None |
| A0A7C8PM62 | 3-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.