DPCstruct | MC1562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 72 ± 13 aa |
| Standard deviation of domain lengths | 13.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4Y8C5 | 2-61 | PDPSHAATIAGLQERFAGVVCWWGIYTYEWWAIVPGGTQWKIVNAEDPDTLVQQILKARN |
| A0A239NYA8 | 188-250 | AAEERSRPVAAAIEREFAGVVAWYGQATGAWWAMVRVHGGVRLVEALSPQELRAAIVRAQGWP |
| A0A7D5AXT9 | 3-101 | None |
| A0A4R5BJ00 | 73-138 | None |
| A0A7K1LBU5 | 7-75 | None |
| A0A1R3UMK3 | 7-105 | None |
| A0A1M6VST2 | 3-96 | None |
| A0A495QTC4 | 6-67 | None |
| A0A6L9QG31 | 1-58 | None |
| A0A6I4MG54 | 21-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.