DPCstruct | MC15619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 201 ± 40 aa |
| Standard deviation of domain lengths | 40.45 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08894 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8FA22 | 68-258 | FLKNPLTGEILSRWRNPYINNRELPVIHIWNNPVNQSLFFSEEEMRFIRRLLPSQILDDELVFYQDIFPFYDSPLPRSEYGHFSQSD… |
| A0A6P0YMN9 | 3-190 | LFCDPVTQEILHYWQPKEDSQKVPVVHIANRMVQGAVRERKVVIPQNSGYVTKVNEIPLEYPHPLAADSKYKDYCPGETFKGVEYFT… |
| A0A7S4SSQ8 | 3-203 | None |
| A0A2D8S7R4 | 9-192 | None |
| A0A0B7FP42 | 430-676 | None |
| A0A0Q4BK22 | 42-255 | None |
| R7QIV0 | 243-496 | None |
| A0A1Z1WPP0 | 43-252 | None |
| A0A1Y1I6G4 | 635-845 | None |
| A0A6M0S9N8 | 45-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.