DPCstruct | MC15618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 176 ± 18 aa |
| Standard deviation of domain lengths | 18.44 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4TNC9 | 526-671 | DDGSYWTWTMDEARAALGGDERLLRAAVLRYGLDDPESAMHGDRERHVPYRALEAPEIAARLELPIAETESLLGEVERRLKAARDRR… |
| A0A838T827 | 1-187 | MTDKEGGFYSAEDADSLLAAGKVEHSEGASYVWSKDEIDRVLGPGRAKVFGYHVGVEPKGNAPADPQGEFKIKNVLIQRHDVADTAK… |
| A0A842ZG13 | 1-152 | None |
| L8GM78 | 510-678 | None |
| A0A444XR43 | 61-243 | None |
| A0A7C5GCN0 | 204-361 | None |
| A0A060S9J0 | 318-509 | None |
| A0A7C3USI3 | 11-162 | None |
| A0A850C3Y8 | 1-188 | None |
| A0A6G1FWR3 | 439-638 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.