DPCstruct | MC15612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 148 ± 23 aa |
| Standard deviation of domain lengths | 23.48 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9EI98 | 1-120 | MRPHPRLRKTMKWGGAAVGVLMLAAWAASERWYLHHYAWPWLYGAQRGGAYLVHDRGAMYRMPPGVYTGRVDPTVPKVWWANASISG… |
| A0A4Q2X527 | 1-138 | MPFRWYRSRLFLFGLAGLVVLLSGWFAFPRTAIQISFGTDLGRFAMMKEDGAVGFSYQHPSCSLLIPTDGFELTHYEQFSGYSIRLF… |
| A0A7C5ZH84 | 3-209 | None |
| A0A858RNV1 | 7-169 | None |
| A0A517U1J4 | 7-156 | None |
| A0A4Q2X710 | 1-150 | None |
| A0A4Q2XCI6 | 2-156 | None |
| A0A4Q2XE23 | 1-130 | None |
| A0A4Q2XE97 | 1-128 | None |
| A0A2G6D5K2 | 3-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.