DPCstruct | MC15611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 142 ± 14 aa |
| Standard deviation of domain lengths | 13.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D4ZWG5 | 110-264 | QPNSLKTRDRDCKLSGVVLADFAQLLPDRTATAVFDQADKRKVTVSVAGAAYRGSKAGKRPPLVEVTVQSKRPGVEGELAWLPVKDA… |
| A0A838I4V9 | 1-145 | LTPDRSATVTVDPHHTRVLRVTVSGVAPRGPKPIVQPEVLPKHLCPRPTRIRLRVQEHDETIGGDLSWKDVAPAIAKVSAFADGRTP… |
| A0A136P4Z0 | 627-765 | None |
| A0A2W1A2X2 | 402-530 | None |
| A0A7X9FVY4 | 257-388 | None |
| A0A3D3JJP0 | 1-167 | None |
| A0A1X4IB03 | 283-403 | None |
| A0A7C6MFB9 | 187-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.