DPCstruct | MC1561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 232 ± 23 aa |
| Standard deviation of domain lengths | 22.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 12.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4X1N5 | 5-252 | SLIAIDDAAIPVTVVTCDVLAQERKPLPLLDEYLLRLVAAGVDEVEEIARTLGLEKFIVEVAAADRISDGSVNYSRIGQTGRLLLTD… |
| A0A2A4X412 | 83-312 | SLEARYTAKQIMETQTSHLLKDGSHTFGEVALRYHPYLLMEVKFTGENMDTQEANILWSMIDGEMVLDTRSWKKTHGFADCINCKAD… |
| A0A0L0JHM4 | 18-242 | None |
| S3UBJ8 | 12-247 | None |
| A0A7J4JGT4 | 106-293 | None |
| A0A7X9IQJ7 | 7-204 | None |
| F8CQW7 | 2-244 | None |
| E1WR07 | 42-261 | None |
| A0A5C5WZE3 | 1-227 | None |
| A0A5P8WEQ0 | 25-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.