DPCstruct | MC15608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Standard deviation of domain lengths | 5.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 54.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4J4A6 | 1-59 | MIRTAATATPEWRAARDHYLAHVMTCQACHAPTSRHCPTGADLRDTYNATPLELPPCPT |
| A0A7T7QAK4 | 51-99 | AAKATPEWRHARDQYISHVMACRNCSMPTGRHCPAGADLRITYDQTPME |
| A0A2T5PD53 | 1-66 | None |
| A0A562I0Z7 | 188-242 | None |
| A0A562HYZ6 | 143-193 | None |
| A0A3R8U4G0 | 17-71 | None |
| A0A1I7DIX6 | 64-118 | None |
| A0A5E7V6W1 | 220-278 | None |
| A0A7C1L6N9 | 20-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.