DPCstruct | MC15606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 203 ± 19 aa |
| Standard deviation of domain lengths | 19.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D9C0B5 | 449-641 | GCLMYELSHSLRKNKNELLWLACVALTDQFVHERLTEERYQAGVMELEQHINSSGNLDAITSVTLKDGTKVTVPDSSRITYEDEPRL… |
| A0A0N7L9C8 | 26-237 | MWMLAERLGRSDNEGLWLAILGLTSQYLTSSIDVEHYERVAALLASDVRALNPSMTADGESDESAVRQKASGGLAGRAVDADDGRIR… |
| D3BKP9 | 399-601 | None |
| A0A1V9ZXW5 | 298-485 | None |
| L1K0Q3 | 448-655 | None |
| A0A835APH1 | 652-839 | None |
| A0A2A4K7M8 | 187-372 | None |
| A0A1J8QI14 | 702-916 | None |
| Q98RQ7 | 150-332 | None |
| A0A226F0S4 | 209-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.