DPCstruct | MC15604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 99 ± 7 aa |
| Standard deviation of domain lengths | 6.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 42.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0E1B7 | 2-99 | EIIKLFMAKEEDLYDKTIDDVFTKEFYESNFWLYWRTMFAFEEWHSAVEMRRYIQRFIHHIGGLPDFSALKFTKYNQYESLILPMVK… |
| A0A357NKQ6 | 22-121 | QWELVKLLLKRKEDLDDVTIEDYFSEGFLQSNFWFFWRSMFAFENWQSLLEMKLYMHRFLDAIDGLNDMSALVFPKYNQYESFVVPL… |
| U6F3L0 | 72-173 | None |
| A0A380CPY2 | 132-240 | None |
| A0A562DHR1 | 2-97 | None |
| A0A1W4UDF4 | 65-164 | None |
| W4UKW5 | 65-172 | None |
| G4D3X9 | 35-127 | None |
| A0A7D8YPR6 | 5-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.