DPCstruct | MC15603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 106 ± 7 aa |
| Standard deviation of domain lengths | 7.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5JF13 | 7-112 | SPTNGAEFVSFNQFTAEAVIVPLISHGRKADVLFRGQSIGFVDKLGEDGLRQAHRRAVNNALYSNEEDDLPHWLHQPLPSTTALSAY… |
| A0A2T6GBL4 | 1-94 | MAPHEMTKAEFMSAAKAEQLVNHGRKWNVTLGTYSSFSDAESEAAAKADVHRGAVNNALYLNTPDCEGMSNDGMPPIRVLVDYLDLV… |
| A0A1D3K8D6 | 9-124 | None |
| A0A656QJ40 | 2-109 | None |
| A0A2N5BQ61 | 1-103 | None |
| A0A2D6QSP5 | 1-112 | None |
| A0A850QFW5 | 125-220 | None |
| A0A158JL44 | 11-115 | None |
| A0A7C9BP46 | 41-147 | None |
| A0A2N8QQW7 | 263-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.