DPCstruct | MC15602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 223 ± 25 aa |
| Standard deviation of domain lengths | 25.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L0XE48 | 1-240 | MGTEAALSVDECKRAVIEFCQRYPIALTIGYVIRDKQEDALGIPEATRERAGTIAGAYFPARRRVALAVSNIRGTQDVERTLRHELL… |
| A0A2T6GBF5 | 1-239 | MDKAEAEQVVQTTLEELGLIDRVRVLIFTDTKEYIDAIEKAVGQSLDRTTRERLEGVQAAYLPVGQAICVVASQSRDPATLHRCVKH… |
| D0L199 | 5-215 | None |
| A0A439EVW6 | 41-252 | None |
| A0A482Z2P5 | 2-209 | None |
| A0A0T5YV55 | 241-453 | None |
| A0A318SDQ4 | 2-239 | None |
| A0A2L0XEA8 | 776-981 | None |
| A0A426WAM2 | 341-568 | None |
| F3CB86 | 1-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.