DPCstruct | MC15600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1036 |
|---|---|
| Mean domain length (aa) | 410 ± 85 aa |
| Standard deviation of domain lengths | 84.70 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.38 |
| Mean intra-cluster sequence similarity (%) | 13.19 |
| Pfam Score | 99.16 |
| Assigned Pfam label(s) | PF04825- PF04674- CL0209- PF21673- CL0507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8MYK3 | 32-520 | SSGYTIGGRSIPMIAFLLAATAASFSGWTFIGHPGLIWRDGLAYAFASFYVLTIPITGTFFAKRNWLFGKRYGFITPGDMFAYYYNS… |
| A0A117RCV0 | 4-451 | GVASTAPAYSLAATLGLIVVAVGLQSPIVVMLSFLPMLLVAYAFRELNASDADCGTTYTWATRAFGPRTGWMGGWGIVVADVIVMAS… |
| A0A1Q9CI65 | 110-440 | None |
| A0A451EJH9 | 2-268 | None |
| A0A3S0ZC74 | 15-450 | None |
| L5KHV0 | 458-892 | None |
| A0A438NFR7 | 448-916 | None |
| A0A7R9PYK0 | 55-554 | None |
| A0A7S3ZVX5 | 2-253 | None |
| A0A4V5N717 | 4-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.