DPCstruct | MC156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 195 |
|---|---|
| Mean domain length (aa) | 218 ± 58 aa |
| Standard deviation of domain lengths | 58.44 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 79.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T2R2N9 | 2-192 | STDTVTRWPNRWVFILAAVGSAAGLGNIWRFPFLAFEHGGAAFVLVLILATLIVGLPLLTLETGLGQKTKMAAPAALGSIKKPLRLV… |
| A0A811WNF2 | 2-211 | SCIGYAAAVMSCWMNVYYIVILAWAVFYFFMSMRADVPWRTCDNYWNTATCVNPYDRKNLTCWSTTDMTSYCTLNGRNVSKIALSDP… |
| A0A226F5D0 | 55-276 | None |
| A0A0G4HF70 | 232-460 | None |
| A0A0D8X8M1 | 76-384 | None |
| A0A6I9Y8D5 | 227-417 | None |
| A0A317B033 | 12-149 | None |
| A0A1I8I5U5 | 707-851 | None |
| A0A819QNS8 | 102-303 | None |
| A0A212CCF8 | 3-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.