DPCstruct | MC15599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 17.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 14.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q39RE2 | 279-439 | SNYDDSLRKSAFNDIKHALFTFKGAPPIAFSGLFYPDYDFKGTQLQYLADHRNDFDLITFCSAPMAKGWGFLFAWHHTSSQICNRFL… |
| A0A6N4DAS3 | 1-150 | MKSYIILRLTDVPSIMCSTIFIPSFDFNGNPLPVHDNLVDEPYICVTVSSDIYGGYIVLQWDKQNIMSQKVISSLHENGLDTNKLLA… |
| A0A1F2R9W3 | 3-173 | None |
| A0A559KAB4 | 199-376 | None |
| A0A2L0A7X4 | 278-414 | None |
| A0A6C0GSM9 | 167-300 | None |
| A0A6G7C8W9 | 226-368 | None |
| W0GR46 | 247-399 | None |
| A0A345QDR0 | 55-226 | None |
| A0A4Q3UYI3 | 130-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.