DPCstruct | MC15598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.00 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0129- CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1DRE9 | 96-188 | TTKTLVGRSEWVGLPSLGTYLKARVDSGANTSSLSAEEITRFERDGENWVRFKLALNEDDVAVESQRDEWIEAPVVRRVRIVQASGE… |
| A0A6N4D370 | 5-110 | KVDPKVANGKVVLGQEEWVWIDSIKAHFKARVDTGATTSSINAQDIQTFERDGKERIRFNLTHQGEDNTDEKAQAAKVDEIEAPVVR… |
| A0A423DTK3 | 6-102 | None |
| A0A1G9UK36 | 1-124 | None |
| A0A553L8W1 | 87-193 | None |
| A0A1I1EPB5 | 118-226 | None |
| A0A0X8HEB9 | 288-392 | None |
| A0A2H9TAD1 | 69-161 | None |
| A0A0B8QB44 | 1-84 | None |
| A0A7H5FRR2 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.