DPCstruct | MC15595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 105 ± 21 aa |
| Standard deviation of domain lengths | 20.64 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12823 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A267T1L8 | 6-96 | SLSANIIRAFLIIGKIEGYSYLFLLFVAMPVKYILHKPEIVKIGGTIHGVLFVAFVATILAMIIQVGMTLRKAMLAFVLSLIPFGTF… |
| A0A258QNS7 | 18-111 | VLRHLSIMTLAEGTTLIALVLIAVPLKYWAGLPIAVKILGPIHGAFFVWAVLVIITAAAQKHLSIGKAAQVFVAALIPFGGLWSHRL… |
| A0A6C2YLM6 | 5-94 | None |
| A0A7X8YD84 | 2-106 | None |
| A0A7Y9LIL1 | 115-215 | None |
| A6GI26 | 151-251 | None |
| A0A7Y3PHE3 | 21-118 | None |
| A0A2D5E7E2 | 49-172 | None |
| A0A858RQN0 | 28-119 | None |
| A0A1Q3N281 | 10-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.