DPCstruct | MC15594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 129 ± 11 aa |
| Standard deviation of domain lengths | 11.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5X1J3 | 136-240 | FEVYPHAAMVRLFGLPRILEYKARPGRSLSHRRRQMQAYTGLFDCLPEPLLYLPEWLSNVPETATGLKRFEDRVDALFCAWMAARAW… |
| A0A1I4JZZ2 | 9-137 | WAVDPRTPTGGDVGVCIEVYPHPALVGLFELPYRLDYKKGNDQRRAPGFRLFVQHLESIPELALLSNPRWAELKQALAAPRRGDLTR… |
| A0A655JBQ5 | 2-144 | None |
| A0A840R563 | 130-249 | None |
| A0A3N5JPM7 | 132-267 | None |
| A0A2E0MI32 | 112-232 | None |
| A0A486XV91 | 109-235 | None |
| A0A661G6Z7 | 205-333 | None |
| A0A3D1P5A1 | 31-177 | None |
| A0A1E5QCT1 | 45-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.