DPCstruct | MC15592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 499 |
|---|---|
| Mean domain length (aa) | 219 ± 46 aa |
| Standard deviation of domain lengths | 45.65 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 16.26 |
| Pfam Score | 98.76 |
| Assigned Pfam label(s) | CL0052- CL0472- CL0612- CL0067- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4AN71 | 1-163 | MCCIIYKPKNVPMPSRDILGKIKRLNHNGYGFVSTNHFHKGLDYRTFLCHLSEVSDDEDCIIHFRLATHGSICRANCHPFSLDGIYF… |
| A0A828TFG1 | 22-248 | TLSRMCGIVGYVGQQPACAVVMAALRRMEYRGYDSSGVALVNGDGTLTVSRRAGRLANLEEAVAQLPPSALTGTTGLGHTRWATHGR… |
| A0A534K4J7 | 265-533 | None |
| A0A168CP30 | 231-430 | None |
| A0A1Q9CEM5 | 605-971 | None |
| A0A1Q9CP53 | 76-395 | None |
| A0A850KB19 | 1-147 | None |
| A0A3N5X636 | 511-790 | None |
| A0A7X9Q8V9 | 277-460 | None |
| A0A0G4HC19 | 84-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.